HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8P4KEU3",
"id": "A0A8P4KEU3_DICLA",
"source_organism": {
"taxId": "13489",
"scientificName": "Dicentrarchus labrax",
"fullName": "Dicentrarchus labrax (European seabass)"
},
"name": "proteasome endopeptidase complex",
"description": [
"The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides"
],
"length": 217,
"sequence": "MEKHCTNSQVKGVSTGTTILAATFDGGVVIGSDSRASMGGEYVSSKTINKVIQVHDQIFCCMAGSLADAQAVTKAAKFHLSFHSVQMESPPLVISAASVLKELCYKNKDELQAGFITAGWDRKKGPQVYVVALGGMLMSQPVTIGGSGSTYIYGYVDAKYKPNMSRDECLQFATNALALAMGRDNVSGGVAHLVVITETGVEHVVVPGNKLPKFHDE",
"proteome": "UP000694389",
"gene": "psmb12",
"go_terms": [
{
"identifier": "GO:0030163",
"name": "protein catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005839",
"name": "proteasome core complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0004298",
"name": "threonine-type endopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d0cadb4b1c9d733ad28db3ac45300c7c0dc1b432",
"counters": {
"domain_architectures": 65712,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 1,
"profile": 1,
"cdd": 1,
"cathgene3d": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 65712
}
}
}