GET /api/protein/UniProt/A0A8P0NKS4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8P0NKS4",
        "id": "A0A8P0NKS4_CANLF",
        "source_organism": {
            "taxId": "9615",
            "scientificName": "Canis lupus familiaris",
            "fullName": "Canis lupus familiaris (Dog)"
        },
        "name": "Tektin",
        "description": [
            "Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia and flagellar axoneme. Forms filamentous polymers in the walls of ciliary and flagellar microtubules. Required for normal sperm mobility"
        ],
        "length": 447,
        "sequence": "MAQTDVLLTKEPTPQAVPACELPQKVYDVARNVGACSSSGLATAGFRSAKYLADEWSQNCYARYHQAFADRNQSERRRHESHQLAAKTQALARCSQEDATRKAGARLQDTHGWKSELQREVGELGTESDLLLAQKQRLARALDATSVPFSIATDNLQCRERRQHPDLVRDCVETELLKEAELIRNIQELLKRTIMQAVNQIRLNREQKETCEMDWSDKVEAYNIDQACAHYHNQSTDVQFHPYSAKFEESASTPETWARFTQENLCRAERERRASANLRVLIDCILRDVAEDLRLQCDAVNLAFGRRCEELEDTRHKLQNHLHKTLREITEQEHNVAALRQAIKDKEAPLKVAQTRLYQRSHRPNVELCRDAAQFRLMSEVEELNMSLTALKEKLLEAEQSLRNLEDTRMDLEKDLAVKANSLFIDRQKCMTHRTHYPTILQLAGYQ",
        "proteome": null,
        "gene": "TEKT4",
        "go_terms": [
            {
                "identifier": "GO:0060294",
                "name": "cilium movement involved in cell motility",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "09e7a151622b90fa75b911f6202b39daffa1ad83",
        "counters": {
            "domain_architectures": 8107,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 8107
        }
    }
}