HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8M5UPY7",
"id": "A0A8M5UPY7_TOBAC",
"source_organism": {
"taxId": "4097",
"scientificName": "Nicotiana tabacum",
"fullName": "Nicotiana tabacum (Common tobacco)"
},
"name": "Eukaryotic translation initiation factor isoform 4E",
"description": [
"(Microbial infection) Susceptibility host factor required for viral infection (e.g. potato virus Y (PVY) and pepper mottle virus (PepMoV)) by recruiting viral RNAs to the host ribosomal complex via an interaction with viral genome-linked protein (VPg)"
],
"length": 195,
"sequence": "MATEAPIEATEVLPAPDTVEKQPHKLERRWTFWFDKPKQGAVWASALRKAYTFETVEEFWSLYDQIFKPSKLTANADFHLFKAGIEPKWEDPECASGGKWTVTSSRKANLETMWLETLMALVGEQFDESEEICGVVASVRRSQDKLSLWTRTASNEAAQMSIGRKWKEIIDAEKISYSFHDDSKKERSVKSRYTV",
"proteome": "UP000790787",
"gene": "LOC107770125",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003743",
"name": "translation initiation factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006413",
"name": "translational initiation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e0d210c4f92eabf1f1927af9673d99c73f29b514",
"counters": {
"domain_architectures": 17558,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17558
}
}
}