GET /api/protein/UniProt/A0A8M5UPY7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8M5UPY7",
        "id": "A0A8M5UPY7_TOBAC",
        "source_organism": {
            "taxId": "4097",
            "scientificName": "Nicotiana tabacum",
            "fullName": "Nicotiana tabacum (Common tobacco)"
        },
        "name": "Eukaryotic translation initiation factor isoform 4E",
        "description": [
            "(Microbial infection) Susceptibility host factor required for viral infection (e.g. potato virus Y (PVY) and pepper mottle virus (PepMoV)) by recruiting viral RNAs to the host ribosomal complex via an interaction with viral genome-linked protein (VPg)"
        ],
        "length": 195,
        "sequence": "MATEAPIEATEVLPAPDTVEKQPHKLERRWTFWFDKPKQGAVWASALRKAYTFETVEEFWSLYDQIFKPSKLTANADFHLFKAGIEPKWEDPECASGGKWTVTSSRKANLETMWLETLMALVGEQFDESEEICGVVASVRRSQDKLSLWTRTASNEAAQMSIGRKWKEIIDAEKISYSFHDDSKKERSVKSRYTV",
        "proteome": "UP000790787",
        "gene": "LOC107770125",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003743",
                "name": "translation initiation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006413",
                "name": "translational initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e0d210c4f92eabf1f1927af9673d99c73f29b514",
        "counters": {
            "domain_architectures": 17558,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17558
        }
    }
}