GET /api/protein/UniProt/A0A8M2BBE6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8M2BBE6",
"id": "A0A8M2BBE6_DANRE",
"source_organism": {
"taxId": "7955",
"scientificName": "Danio rerio",
"fullName": "Danio rerio (Zebrafish)"
},
"name": "Ataxin-7-like protein 3",
"description": [
"Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription"
],
"length": 343,
"sequence": "MKMEDMSLSGLDNTKLEALAHDVYSDLVEDACLGLCFEVHRAVKQGYFFLDETDQESMKDFEIVDQPGVDIFGQVYNQWKNKECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIASSNNTSKSESDQEDNDDINDNDWSYGSEKKAKKRKSEKNPNSPRRSKSLKHKNGELSGGVNPDMYKYNYSSGISYETLGPEELRSILTTQCGVVSEHTKKMCTRSTLPDADTMLENEAYEPPDGQLIMSRLHWDASSDISPSDSASSKASTNNSESKRPKKKKPSTLSLTPAGERDKAQERDRIAGSGSSGSSSQNALGLSSRKKRPKLAVPPAPSIYDDLN",
"proteome": "UP000000437",
"gene": "atxn7l3a",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "36ee558566e637e6a3bbab59028da8ccf0aedd65",
"counters": {
"domain_architectures": 636,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cathgene3d": 2,
"panther": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 636
}
}
}