GET /api/protein/UniProt/A0A8J7LLN0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8J7LLN0",
        "id": "A0A8J7LLN0_9FLAO",
        "source_organism": {
            "taxId": "2798802",
            "scientificName": "Snuella sedimenti",
            "fullName": "Snuella sedimenti"
        },
        "name": "Kynureninase",
        "description": [
            "Catalyzes the cleavage of L-kynurenine (L-Kyn) and L-3-hydroxykynurenine (L-3OHKyn) into anthranilic acid (AA) and 3-hydroxyanthranilic acid (3-OHAA), respectively"
        ],
        "length": 424,
        "sequence": "MLSYKLGLEYAKELDQNDVLATYRERFYIPKNKRGEELIYMTGNSLGLQPKVTKTYIDKELSDWAILGVEGHTQGETPWLPYHEFLAENMAMVVGAKPIEVVVMNTLTANLHLMMVSFYRPTKSRYKILIESDAFPSDKYAVESQLRHHGFDEKDGVVLWKPRHGETLLRYEDLETIMASQGNEIALIMIGGVNYYTGQYFDLKRITELGHKYGCTVGFDCAHGAGNVNLDLHDSGADFAVWCTYKYLNSGPGSLAGCFVHERHAYNKELNRFTGWWSHNKQTRFNMRDDFDQLPGAEGWQLSNPPILSMAAIKASLDMFGEVGMLALTEKSKQLTGYFEFLLQQLGDHTINIITPKNPEERGCQLSIQVKNADKTLHEKLNEAGVLSDWREPDVMRCAPVPLYNSFQDVYLLVEKLKVILNDK",
        "proteome": "UP000610931",
        "gene": "kynU",
        "go_terms": [
            {
                "identifier": "GO:0030170",
                "name": "pyridoxal phosphate binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030429",
                "name": "kynureninase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006569",
                "name": "L-tryptophan catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009435",
                "name": "NAD+ biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "39901a599ed8bfa04284073fd8aaddba19cf5b1f",
        "counters": {
            "domain_architectures": 10656,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "pfam": 1,
                "hamap": 1,
                "pirsf": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10656
        }
    }
}