HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8J6GX70",
"id": "A0A8J6GX70_MICOH",
"source_organism": {
"taxId": "79684",
"scientificName": "Microtus ochrogaster",
"fullName": "Microtus ochrogaster (Prairie vole)"
},
"name": "Monocarboxylate transporter 6",
"description": [
"Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate"
],
"length": 471,
"sequence": "MPQVLEQPDGRWAWVVLLTCMVAQALTLGFPSCIGVFFTDLQRDFQATNSETSWFPSIMGAMLHGGGPLCSILIKRFGCRVTMMLGGMLSSLGMVASSFSGSLNQLFLTAGLITGLGMCFSFQSSITVMGLYFVRRRPLANALVSIGNSLGVTLWPLLARYLLETLGWRGAFLIFGGILLHCCVCGAILRPVATHVASEPKEDPPPPPKTPTRSCLATCVSTIRYHLALDLLRHNMGFCIYVVGVTWMTLGFPLPHIFLVPYAMHHGVDQYWAAMLMSVVGFCNIFLRPVAGLLAGRKSLAAYRKYLFTAAILVNGLTNLICTVSADFSVLLSYCLVYSLSMCVIGILIFEVLMDTVPMDRFPSALGLFTVLCGVASLISPPLAGLLLDMTNNFKSIFYASSFLLISASLFIGGGFYAEEKKKKKKLKQNGQAKVEDTISESAPMQGLSSEDKDGARKQLCPESICYVTSV",
"proteome": null,
"gene": "LTLLF_115160",
"go_terms": [
{
"identifier": "GO:0022857",
"name": "transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008028",
"name": "monocarboxylic acid transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015718",
"name": "monocarboxylic acid transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0cf2ecc0af7bf39512b66dc61c541f5a27eedca6",
"counters": {
"domain_architectures": 68271,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"ncbifam": 1,
"panther": 1,
"pfam": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 68271
}
}
}