GET /api/protein/UniProt/A0A8J6GX70/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8J6GX70",
        "id": "A0A8J6GX70_MICOH",
        "source_organism": {
            "taxId": "79684",
            "scientificName": "Microtus ochrogaster",
            "fullName": "Microtus ochrogaster (Prairie vole)"
        },
        "name": "Monocarboxylate transporter 6",
        "description": [
            "Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate"
        ],
        "length": 471,
        "sequence": "MPQVLEQPDGRWAWVVLLTCMVAQALTLGFPSCIGVFFTDLQRDFQATNSETSWFPSIMGAMLHGGGPLCSILIKRFGCRVTMMLGGMLSSLGMVASSFSGSLNQLFLTAGLITGLGMCFSFQSSITVMGLYFVRRRPLANALVSIGNSLGVTLWPLLARYLLETLGWRGAFLIFGGILLHCCVCGAILRPVATHVASEPKEDPPPPPKTPTRSCLATCVSTIRYHLALDLLRHNMGFCIYVVGVTWMTLGFPLPHIFLVPYAMHHGVDQYWAAMLMSVVGFCNIFLRPVAGLLAGRKSLAAYRKYLFTAAILVNGLTNLICTVSADFSVLLSYCLVYSLSMCVIGILIFEVLMDTVPMDRFPSALGLFTVLCGVASLISPPLAGLLLDMTNNFKSIFYASSFLLISASLFIGGGFYAEEKKKKKKLKQNGQAKVEDTISESAPMQGLSSEDKDGARKQLCPESICYVTSV",
        "proteome": null,
        "gene": "LTLLF_115160",
        "go_terms": [
            {
                "identifier": "GO:0022857",
                "name": "transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008028",
                "name": "monocarboxylic acid transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015718",
                "name": "monocarboxylic acid transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0cf2ecc0af7bf39512b66dc61c541f5a27eedca6",
        "counters": {
            "domain_architectures": 68271,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "ncbifam": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 68271
        }
    }
}