General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8J6GS17",
        "id": "A0A8J6GS17_MICOH",
        "source_organism": {
            "taxId": "79684",
            "scientificName": "Microtus ochrogaster",
            "fullName": "Microtus ochrogaster (Prairie vole)"
        },
        "name": "Prostamide/prostaglandin F synthase",
        "description": [
            "Catalyzes the reduction of prostaglandin-ethanolamide H(2) (prostamide H(2)) to prostamide F(2alpha) with NADPH as proton donor. Also able to reduce prostaglandin H(2) to prostaglandin F(2alpha)"
        ],
        "length": 233,
        "sequence": "MSAVDLSRVGACVLKHAVTGEAVELRSLWQDKACVVAGLRRFGCMVCRWIAQDLSNLRSFLDQHDVRLVGVGPEALGLQEFLDGGYFSGELYLDESKQFYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFIQKSPGDYVPQEDVLQALGISAEVSSSKPPQDQAPLIPGVGGRLHSRPVRRAGWRLQWPSGKDLHIQLHLS",
        "proteome": null,
        "gene": "LTLLF_133555",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "443fb9c0d4ac90645217a3004302a8d616e2ab64",
        "counters": {
            "domain_architectures": 9787,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 9787
        }
    }
}