GET /api/protein/UniProt/A0A8J0UI03/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8J0UI03",
        "id": "A0A8J0UI03_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "WD repeat-containing protein 4",
        "description": [
            "Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. In the complex, it is required to stabilize and induce conformational changes of the catalytic subunit"
        ],
        "length": 431,
        "sequence": "MTRCLVTTSNVTVTRRETQTREWCRTGKEMLRVGPGSLAITGGSRLLGHRVGIDCCPFHLDCSLLEKQSAAPGVVPFPRQEGSADPHVSDKILAAAFSPSGEYFALTDDNKRLVLFRTKPVWEKISVRWVSRRCTALTFSPCGNHILVADKSGDVFSFSVPRALEQGRLELGHLSMLLDVTISLDGKHIITCDRDEKIRVSCWGAPHVIMSFCLGHTEFVSQLLPLPGQEKLLLSGSGDGTLRLWEYESGKEVHSVTLRSLAHELEDQENKRFAVSRISCCSCNGIQLAVLCEGVPGIFLFSVSPEPRLTFTQYIALTHTPIDLDFDGSAFLWVLSGVGEEPLLKYKELDGQWQSVSNDEELTRLTGIIQENWGDLEGAGAPESRFVGLYKAVFDNMATYLQKKELRLESEKRKAADGQVVLASKVQKTES",
        "proteome": "UP000186698",
        "gene": "wdr4.S",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0036265",
                "name": "RNA (guanine-N7)-methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5a1e7e096f9d8c9417e859b3237d576a7f277f97",
        "counters": {
            "domain_architectures": 73335,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 2,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 73335
        }
    }
}