GET /api/protein/UniProt/A0A8J0UI03/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8J0UI03",
"id": "A0A8J0UI03_XENLA",
"source_organism": {
"taxId": "8355",
"scientificName": "Xenopus laevis",
"fullName": "Xenopus laevis (African clawed frog)"
},
"name": "WD repeat-containing protein 4",
"description": [
"Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. In the complex, it is required to stabilize and induce conformational changes of the catalytic subunit"
],
"length": 431,
"sequence": "MTRCLVTTSNVTVTRRETQTREWCRTGKEMLRVGPGSLAITGGSRLLGHRVGIDCCPFHLDCSLLEKQSAAPGVVPFPRQEGSADPHVSDKILAAAFSPSGEYFALTDDNKRLVLFRTKPVWEKISVRWVSRRCTALTFSPCGNHILVADKSGDVFSFSVPRALEQGRLELGHLSMLLDVTISLDGKHIITCDRDEKIRVSCWGAPHVIMSFCLGHTEFVSQLLPLPGQEKLLLSGSGDGTLRLWEYESGKEVHSVTLRSLAHELEDQENKRFAVSRISCCSCNGIQLAVLCEGVPGIFLFSVSPEPRLTFTQYIALTHTPIDLDFDGSAFLWVLSGVGEEPLLKYKELDGQWQSVSNDEELTRLTGIIQENWGDLEGAGAPESRFVGLYKAVFDNMATYLQKKELRLESEKRKAADGQVVLASKVQKTES",
"proteome": "UP000186698",
"gene": "wdr4.S",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0036265",
"name": "RNA (guanine-N7)-methylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5a1e7e096f9d8c9417e859b3237d576a7f277f97",
"counters": {
"domain_architectures": 73335,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"cathgene3d": 1,
"ssf": 1,
"profile": 2,
"pfam": 1,
"hamap": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 73335
}
}
}