General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8J0U749",
        "id": "A0A8J0U749_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Translation initiation factor eIF2B subunit alpha",
        "description": [
            "Acts as a component of the translation initiation factor 2B (eIF2B) complex, which catalyzes the exchange of GDP for GTP on eukaryotic initiation factor 2 (eIF2) gamma subunit. Its guanine nucleotide exchange factor activity is repressed when bound to eIF2 complex phosphorylated on the alpha subunit, thereby limiting the amount of methionyl-initiator methionine tRNA available to the ribosome and consequently global translation is repressed"
        ],
        "length": 255,
        "sequence": "MNEEEIVQYFKCQLQEDTNVATAVAAIKTLLEFLKRDTGKDYDKCKKMMSERGELFLKRISMSRNKITTLCCPFIKDGAKILTHAYSKVVLKVLEEAAASKNFSVYVTESQPDLSGKIMAEALRNRNVPVTLILDAAVGYIMEKVDLVIVGAEGVVESGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQRDVPDKFKYKADTQQQDLLEEHPWIDYTSPSLITMLFTDLGVLTPSAISDELIKLYL",
        "proteome": "UP000186698",
        "gene": "eif2b1.S",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "22494587f6b739b485007c3a0a6eb4fbe55754ab",
        "counters": {
            "domain_architectures": 30139,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 30139
        }
    }
}