GET /api/protein/UniProt/A0A8I6TF66/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8I6TF66",
        "id": "A0A8I6TF66_CIMLE",
        "source_organism": {
            "taxId": "79782",
            "scientificName": "Cimex lectularius",
            "fullName": "Cimex lectularius (Bed bug)"
        },
        "name": "Glycerol-3-phosphate dehydrogenase [NAD(+)]",
        "description": null,
        "length": 357,
        "sequence": "MAPKKICVIGSGNWGSAIAMIVGTNAMKALNTFNQTVNMYVYEEIVDGQKLSDIINNEHENVKYLPGRKLPANVVAVPSLENAAMDADILIFVIPHQYVKTICTCLSGLVKPTTIAISLIKGFEKTESGSIELISHLIHDMLKIEVCVLMGANLANEVADGQFCETTIGCKNRKYNGMLKELFETPFFRVSIVDDAETVEICGALKNIVACAAGFCDGLLLGDNTKAAIIRLGLMEMISFVNLFHSTSRLSTFFESCGIADLVTTCYGGRNRRIAEAFVKSAKPLAVLERDMLNGQKLQGPITAEEVNVFLKYKNAEERFPLFTTVHKICIGTIKAEKLVDSLRDHPVHQLGLKSNL",
        "proteome": "UP000494040",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006072",
                "name": "glycerol-3-phosphate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016616",
                "name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051287",
                "name": "NAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046168",
                "name": "glycerol-3-phosphate catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042803",
                "name": "protein homodimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "46cafe0a4d005ca4997d310406050087410e4ba4",
        "counters": {
            "domain_architectures": 35267,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 35267
        }
    }
}