General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8I6B3Y3",
        "id": "A0A8I6B3Y3_RAT",
        "source_organism": {
            "taxId": "10116",
            "scientificName": "Rattus norvegicus",
            "fullName": "Rattus norvegicus (Rat)"
        },
        "name": "Mannose-P-dolichol utilization defect 1 protein",
        "description": [
            "Required for normal utilization of mannose-dolichol phosphate (Dol-P-Man) in the synthesis of N-linked and O-linked oligosaccharides and GPI anchors"
        ],
        "length": 259,
        "sequence": "MAGLSGLAEATFPTWRARLTDRSKGCWYQFFYLRNAMINSSSTGTCFMFPASRFSSAKALGWASWLGHFLLPQIFKLLGAKSAEGLSLQSVMLELVALTGTMVYSITNNFPFSSWGEALFLTLQTVTICFLVMHYRGETVKGVAFLVCFAVVLLALLSPVMPLAVPTLLQASNVPAVVVGKLLQAATNYHNGHTGQLSAITVFMLFGGSLARIFTSVQETGDPLMAGVFVVSSLCNGLIAAQVLFYWNAKAPHKQKKQQ",
        "proteome": "UP000002494",
        "gene": "Mpdu1",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "701ead47da4ca89536df1a48132c4e9e9015581f",
        "counters": {
            "domain_architectures": 19165,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 19165
        }
    }
}