GET /api/protein/UniProt/A0A8I6A2V4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8I6A2V4",
"id": "A0A8I6A2V4_RAT",
"source_organism": {
"taxId": "10116",
"scientificName": "Rattus norvegicus",
"fullName": "Rattus norvegicus (Rat)"
},
"name": "Trimeric intracellular cation channel type A",
"description": [
"Intracellular monovalent cation channel required for maintenance of rapid intracellular calcium release. Acts as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores. Opened by a change of voltage within the sarcoplasmic reticulum lumen"
],
"length": 271,
"sequence": "MWCYGGGAKASNTLGSVELSRRHPVASWLCAMLHCFGSYILADLLLGEPIIDYFSNSSSILLASGVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKEVVRVRKIAVGIHHAHHHYHHGWFIMIATGWVKGSGVALLSNLEQLLRGVWKPETNEILHMSFPTKASLYGAILFTLQQTRWLPVSKASLIFVFTMFMVSCKVFLTATHSHSSPFDVLEGYICPVLFGATWGGDHHHDNHGAPHGMGLGTQHSGLPAKAKEELSEGFRKKKTKKAD",
"proteome": "UP000002494",
"gene": "Tmem38a",
"go_terms": [
{
"identifier": "GO:0005267",
"name": "potassium channel activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042802",
"name": "identical protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0071805",
"name": "potassium ion transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e829a56002dad33062cac2ad912424016b323364",
"counters": {
"domain_architectures": 2815,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2815
}
}
}