General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8I3W505",
        "id": "A0A8I3W505_CALJA",
        "source_organism": {
            "taxId": "9483",
            "scientificName": "Callithrix jacchus",
            "fullName": "Callithrix jacchus (White-tufted-ear marmoset)"
        },
        "name": "Cilia and flagella associated protein 68",
        "description": [
            "Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating"
        ],
        "length": 199,
        "sequence": "MVIWVILSLELGKPGLVTSLKNMEQPNKDFCPSPKKSSSSSTYSTSSYSSSEKRQNLACFLTNPHCGSLIHADGHGEVWTDWNSTSKFFQYGWRCTTNENTYSNRTLMGNWNQERYDLRNVVQPKPLPSQFGHYFETTYDTSYNNKMPLSTHRFKREPHWFPGHQPELDPPQYKCTEKSTYMNSYSKPQVGHHSGRIRS",
        "proteome": "UP000008225",
        "gene": "CFAP68",
        "go_terms": [
            {
                "identifier": "GO:0030317",
                "name": "flagellated sperm motility",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5c35ad9d711ab8d6945bf1e67fcc6d8d63a6bf7d",
        "counters": {
            "domain_architectures": 657,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 657
        }
    }
}