GET /api/protein/UniProt/A0A8I3PQ21/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8I3PQ21",
"id": "A0A8I3PQ21_CANLF",
"source_organism": {
"taxId": "9615",
"scientificName": "Canis lupus familiaris",
"fullName": "Canis lupus familiaris (Dog)"
},
"name": "Serine/threonine-protein phosphatase 2A activator",
"description": [
"PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Acts as a regulatory subunit for serine/threonine-protein phosphatase 2A (PP2A). Modulates PP2A activity or substrate specificity, probably by inducing a conformational change in the catalytic subunit, a proposed direct target of the PPIase. Can reactivate inactive phosphatase PP2A-phosphatase methylesterase complexes (PP2A(i)) in presence of ATP and Mg(2+). Reversibly stimulates the variable phosphotyrosyl phosphatase activity of PP2A core heterodimer PP2A(D) in presence of ATP and Mg(2+) (in vitro). The phosphotyrosyl phosphatase activity is dependent of an ATPase activity of the PP2A(D):PPP2R4 complex. Is involved in apoptosis; the function appears to be independent from PP2A"
],
"length": 294,
"sequence": "MAEGERQSPPDSSEDIPPATQNFIIPKKEIHTVPDMGKWKRSQAIEKLVALLNTLDRWIDEIPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTCLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPFLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSC",
"proteome": "UP000805418",
"gene": "PTPA",
"go_terms": [
{
"identifier": "GO:0019211",
"name": "phosphatase activator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "72ff6fad7eb2a23f6de70223ef85ba73d19c8cc3",
"counters": {
"domain_architectures": 7072,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cdd": 1,
"cathgene3d": 1,
"pirsf": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7072
}
}
}