GET /api/protein/UniProt/A0A8H9Z0N8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8H9Z0N8",
        "id": "A0A8H9Z0N8_9PSED",
        "source_organism": {
            "taxId": "2745518",
            "scientificName": "Pseudomonas tritici",
            "fullName": "Pseudomonas tritici"
        },
        "name": "Membrane-bound lytic murein transglycosylase F",
        "description": [
            "Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella"
        ],
        "length": 486,
        "sequence": "MFSPTALRPRCAKWLIATGLFLMLSACVDKPSTLERIKEDGVLRVITRNSPATYFQDRNGETGFEYELVKRFADDLGVKLEIETADNLDDLFGQLGKPNGPVLAAAGLVSSEQRQTQVRFSHPYLEVTPQIIYRNGQSRPTNAADLVGKKIMVLKGSTHAEQLAALKKQNPAIEYEESDAVEVVDLLRMVDEGQIDLTLVDSNEVAMNQVYFPNVRVAFDLGNASNQSWAVAAGEDNSLLNEINSYLDKVEKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPKYEKHFRAYAKEEKVDWRLLAAIGYQESLWQPAVTSKTGVRGLMMLTQNTAQAMGVSNRLDPKQSIMGGAKYLAKIKDELDDSIAEPDRTWFALAAYNVGTGHLEDARTLAKREGLNPNKWLDVKKMLPRLSQKQWYSKTRYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGNQVVEGNLHVPGVDKTKPPEDNQPL",
        "proteome": "UP000615613",
        "gene": "mltF",
        "go_terms": [
            {
                "identifier": "GO:0016837",
                "name": "carbon-oxygen lyase activity, acting on polysaccharides",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008933",
                "name": "peptidoglycan lytic transglycosylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000270",
                "name": "peptidoglycan metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fc6787764f3f0d0150b40ff9e16640fa9967e9c0",
        "counters": {
            "domain_architectures": 6091,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 2,
                "smart": 1,
                "pfam": 2,
                "ssf": 2,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6091
        }
    }
}