GET /api/protein/UniProt/A0A8H9GCT3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8H9GCT3",
"id": "A0A8H9GCT3_9MICO",
"source_organism": {
"taxId": "43677",
"scientificName": "Promicromonospora citrea",
"fullName": "Promicromonospora citrea"
},
"name": "Phosphoribosylformylglycinamidine synthase subunit PurQ",
"description": [
"Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL"
],
"length": 245,
"sequence": "MTVAQETAAAPITGARIGVITFPGTLDDRDAARAVRLAGAEAVSLWHGDESLHDVDAVVLPGGFSYGDYLRAGAISRFAPAMSAVVDAAKGGMPVLGICNGFQVLTEAHLLPGSMVKNDHLHFVCREQAMVVENAHTAWTNEFRRGQRITVPLKNQDGQFVADERTLDELEGEGRVVFRYDGWNPNGSRRDIAGITNERGNVVGLMPHPEHAVEPGFGPASQEGPRAGTDGLTFFTSVLSSLVHA",
"proteome": "UP000655589",
"gene": "purQ",
"go_terms": [
{
"identifier": "GO:0004642",
"name": "phosphoribosylformylglycinamidine synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006189",
"name": "'de novo' IMP biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "afbd56c2c10b9299aa30d33c40c9e41ccd020289",
"counters": {
"domain_architectures": 14191,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"smart": 1,
"cathgene3d": 1,
"pfam": 1,
"profile": 1,
"cdd": 1,
"hamap": 1,
"pirsf": 1,
"ncbifam": 2,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 14191
}
}
}