HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8H6F3Y7",
"id": "A0A8H6F3Y7_CANAX",
"source_organism": {
"taxId": "5476",
"scientificName": "Candida albicans",
"fullName": "Candida albicans (Yeast)"
},
"name": "NAD-dependent protein deacylase",
"description": [
"NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins. Has weak NAD-dependent protein deacetylase activity; however this activity may not be physiologically relevant in vivo"
],
"length": 306,
"sequence": "MNKQLKEFQEYLPKCRKIIALVGAGLSASSGLPTFRGSQGLWKNFNMIDLATPDAFYIDPGLVWQFYSWRRYGALRAKPNKGHYALSKLSHKFNSDEYITITQNVDGLSSRSGHNLDSLYEIHGSLFDLKCTSFMCNYIDHNNFKQPLTKALEDTEFEYSNLSTRKRTFGDSDGNDGVDISLSPQFNPVKTISEKDLPSCPVCHDLLRPGVVWFGESLPLNLITEIDSFVESDPSVDLILVIGTSGTVYPANSYVERVRLKGGKVAIFNTDIEDNILNGKVEDTWGFKGDAAELLPIALKPLIGDI",
"proteome": null,
"gene": "FOB64_002462",
"go_terms": [
{
"identifier": "GO:0036054",
"name": "protein-malonyllysine demalonylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0036055",
"name": "protein-succinyllysine desuccinylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0070403",
"name": "NAD+ binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d025c4a47877c4dc4d451880aa4615a59586b83c",
"counters": {
"domain_architectures": 50198,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"ssf": 1,
"cathgene3d": 2,
"cdd": 1,
"panther": 1,
"hamap": 1,
"pfam": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 50198
}
}
}