HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8H5K2E0",
"id": "A0A8H5K2E0_9HYPO",
"source_organism": {
"taxId": "48495",
"scientificName": "Fusarium pseudoanthophilum",
"fullName": "Fusarium pseudoanthophilum"
},
"name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial",
"description": [
"O-methyltransferase required for two non-consecutive steps during ubiquinone biosynthesis. Catalyzes the 2 O-methylation of 3,4-dihydroxy-5-(all-trans-polyprenyl)benzoic acid into 4-hydroxy-3-methoxy-5-(all-trans-polyprenyl)benzoic acid. Also catalyzes the last step of ubiquinone biosynthesis by mediating methylation of 3-demethylubiquinone into ubiquinone. Also able to mediate the methylation of 3-demethylubiquinol into ubiquinol"
],
"length": 303,
"sequence": "MPAPSRPAGALFRNLARSSRRPFALPLPASHTIAASITTLPTPRWHSTSSSNSSQNFSSVNPDEVSHFNALAADWWDPYGSSRLLHLMNPLRHDFIRACHRNDPDSPTRDLTFLDIGCGGGIFAESAARLPTTRHVTAIDPTPEVLAVARSHARKDPSLRSKLEYRQTSIENLPIPATPQEAYDVVSLFEVIEHIDAPGAFLEKVRPFVKPGGWLVMSTIARTWMSWFTTNFMAEDVLGIVPKGTHDWNKYLNEEELRTFLAGRGWSHPMVQGVIYVPGLGWKQVDGSEKVGNYFFAVRKSEA",
"proteome": "UP000544095",
"gene": "COQ3",
"go_terms": [
{
"identifier": "GO:0010420",
"name": "polyprenyldihydroxybenzoate methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0061542",
"name": "3-demethylubiquinol 3-O-methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006744",
"name": "ubiquinone biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "eb9a14d70d4516727bf14e2208cd8a14fcc4dabf",
"counters": {
"domain_architectures": 92911,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 92911
}
}
}