GET /api/protein/UniProt/A0A8H5K2E0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8H5K2E0",
        "id": "A0A8H5K2E0_9HYPO",
        "source_organism": {
            "taxId": "48495",
            "scientificName": "Fusarium pseudoanthophilum",
            "fullName": "Fusarium pseudoanthophilum"
        },
        "name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial",
        "description": [
            "O-methyltransferase required for two non-consecutive steps during ubiquinone biosynthesis. Catalyzes the 2 O-methylation of 3,4-dihydroxy-5-(all-trans-polyprenyl)benzoic acid into 4-hydroxy-3-methoxy-5-(all-trans-polyprenyl)benzoic acid. Also catalyzes the last step of ubiquinone biosynthesis by mediating methylation of 3-demethylubiquinone into ubiquinone. Also able to mediate the methylation of 3-demethylubiquinol into ubiquinol"
        ],
        "length": 303,
        "sequence": "MPAPSRPAGALFRNLARSSRRPFALPLPASHTIAASITTLPTPRWHSTSSSNSSQNFSSVNPDEVSHFNALAADWWDPYGSSRLLHLMNPLRHDFIRACHRNDPDSPTRDLTFLDIGCGGGIFAESAARLPTTRHVTAIDPTPEVLAVARSHARKDPSLRSKLEYRQTSIENLPIPATPQEAYDVVSLFEVIEHIDAPGAFLEKVRPFVKPGGWLVMSTIARTWMSWFTTNFMAEDVLGIVPKGTHDWNKYLNEEELRTFLAGRGWSHPMVQGVIYVPGLGWKQVDGSEKVGNYFFAVRKSEA",
        "proteome": "UP000544095",
        "gene": "COQ3",
        "go_terms": [
            {
                "identifier": "GO:0010420",
                "name": "polyprenyldihydroxybenzoate methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0061542",
                "name": "3-demethylubiquinol 3-O-methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006744",
                "name": "ubiquinone biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "eb9a14d70d4516727bf14e2208cd8a14fcc4dabf",
        "counters": {
            "domain_architectures": 92911,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 92911
        }
    }
}