General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8G1VMY5",
        "id": "A0A8G1VMY5_9EURO",
        "source_organism": {
            "taxId": "1448313",
            "scientificName": "Aspergillus piperis CBS 112811",
            "fullName": "Aspergillus piperis CBS 112811"
        },
        "name": "Actin-related protein 2/3 complex subunit 4",
        "description": [
            "Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the mother actin filament"
        ],
        "length": 192,
        "sequence": "MSQSLRPYLLAVRSSLTAALAISNFASQTSERHNVPEIEAATSPELLLNPLTISRNENERVLIEPSVNSVRVSIRIKQADEIEHILVHKFTRFLTQRAESFFILRRKPVKGYDISFLITNFHTEQMLKHKLVDFIIQLYVSSALPIYRLINERLTTSSSDSMEEVDKEISEMKLFLNARARFVAESFLTPFD",
        "proteome": "UP000249526",
        "gene": "BO85DRAFT_394795",
        "go_terms": [
            {
                "identifier": "GO:0030041",
                "name": "actin filament polymerization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0034314",
                "name": "Arp2/3 complex-mediated actin nucleation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005885",
                "name": "Arp2/3 protein complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0015629",
                "name": "actin cytoskeleton",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ba4bd2f320827d1e2de4d2fc89b584ec7cb30ead",
        "counters": {
            "domain_architectures": 5289,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "pirsf": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5289
        }
    }
}