GET /api/protein/UniProt/A0A8F9RUK3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8F9RUK3",
        "id": "A0A8F9RUK3_CAMFO",
        "source_organism": {
            "taxId": "104421",
            "scientificName": "Camponotus floridanus",
            "fullName": "Camponotus floridanus (Florida carpenter ant)"
        },
        "name": "Troponin T",
        "description": [
            "Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity"
        ],
        "length": 345,
        "sequence": "MSDDEEQYSGRASQKESGENIEFMKRQEQKRSDLDEQLKEYIAEWRKQRAKEEDELKRLKDKQAKRKVTRADEEKRLAQKKKEEEERRQREIEEKKQRDIEEKRRRLEESEKKRQAMMQAMKDQSKAKGPNFTITKKDLAGNLTSAQVERNKTKEQLEEEKKISLSIRIKPLEIENLSIDKLRVKATELWESIVKLETEKYDLEERQKRQDYDLKELKERQKQQLRHKALKKGLDPEALTGKYPPKIQVASKYERRVDTRSYDDKKKLFEGGLDTLLAETSEKVWKQRSEQFMKRSKTKLPKWFGERPGKKPGDPESPEGEEDVKAAAEDDLEEPQFEEEEEEEE",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0006937",
                "name": "regulation of muscle contraction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005861",
                "name": "troponin complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e87376e55612704cb38509e8056e1fce9be7d25a",
        "counters": {
            "domain_architectures": 15375,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 15375
        }
    }
}