HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8F5ILV9",
"id": "A0A8F5ILV9_CTEID",
"source_organism": {
"taxId": "7959",
"scientificName": "Ctenopharyngodon idella",
"fullName": "Ctenopharyngodon idella (Grass carp)"
},
"name": "Myeloid differentiation primary response protein MyD88",
"description": [
"Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response"
],
"length": 284,
"sequence": "MASKSSIDHEVIPVTALNCNFRKKLGLYLNPQNTVAADWRTVAEMMDFTYLEIKNFEKRDYPFEKVLTEWETRPEATVANLLSILEKAERKDVISDLKEIIDDDCRKYLERQLRKPVQVPVVDSCGPRTQEREGITLFDDPQGLIPETFDAFICYCQNDFQFVHEMIKQLEQTEYNLKLCVFDRDVLPGTCVWTIASELIEKRCKRMVVVISDDYLDSDACDFQTKFALSLCPGARTKRLIPVVYKTMKKPFPSILRFLTICDYTRPCTQAWFWTRLAKALALP",
"proteome": null,
"gene": "MyD88",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007165",
"name": "signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0070976",
"name": "TIR domain binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0002755",
"name": "MyD88-dependent toll-like receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0043123",
"name": "positive regulation of canonical NF-kappaB signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e1dfea92889ab4967c54a36bc5dbff4910fc15fa",
"counters": {
"domain_architectures": 1089,
"entries": 19,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 2,
"cathgene3d": 2,
"ssf": 2,
"cdd": 1,
"pfam": 2,
"profile": 2,
"pirsf": 1,
"panther": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1089
}
}
}