General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8F4XGC6",
        "id": "A0A8F4XGC6_9GENT",
        "source_organism": {
            "taxId": "1892708",
            "scientificName": "Gentiana tetraphylla",
            "fullName": "Gentiana tetraphylla"
        },
        "name": "Cytochrome b6-f complex subunit 5",
        "description": [
            "Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. PetG is required for either the stability or assembly of the cytochrome b6-f complex"
        ],
        "length": 37,
        "sequence": "MIEVFLFGIVLGLIPITLAGLFVTAYLQYRRGDQLDL",
        "proteome": null,
        "gene": "petG",
        "go_terms": [
            {
                "identifier": "GO:0009512",
                "name": "cytochrome b6f complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e883d695708255d85919c062f74378f12f3249e6",
        "counters": {
            "domain_architectures": 13580,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "ncbifam": 1,
                "pirsf": 1,
                "pfam": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 13580
        }
    }
}