GET /api/protein/UniProt/A0A8F4TK02/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8F4TK02",
"id": "A0A8F4TK02_DROEU",
"source_organism": {
"taxId": "29029",
"scientificName": "Drosophila eugracilis",
"fullName": "Drosophila eugracilis (Fruit fly)"
},
"name": "NADH-ubiquinone oxidoreductase chain 1",
"description": [
"Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone"
],
"length": 315,
"sequence": "MFYMEFVLSLIGSLLLIICVLVSVAFLTLLERKVLGYIQIRKGPNKVGLMGIPQPFCDAIKLFTKEQTYPLLSNYLSYYISPIFSLFLSLIVWMCMPFFVKLYSFNLGGLFFLCCTSLGVYTVMIAGWSSNSNYALLGGLRAVAQTISYEVSLALILLSFIFLIGSYNMIYFYYYQIYMWFLIILFPMALVWLTISLAETNRTPFDFAEGESELVSGFNVEYSSGGFALIFMAEYASILFMSMLFCVIFLGCDVFNLLFYIKLTFISFVFIWARGTLPRFRYDKLMYLAWKCFLSFSLNYLLFFIGFKILLFSLL",
"proteome": null,
"gene": "ND1",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "864b30094953a8b5e4deba394bc1ff33053fe7c1",
"counters": {
"domain_architectures": 93545,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"hamap": 1,
"panther": 1,
"pfam": 1,
"prosite": 2,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 93545
}
}
}