GET /api/protein/UniProt/A0A8F4TK02/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8F4TK02",
        "id": "A0A8F4TK02_DROEU",
        "source_organism": {
            "taxId": "29029",
            "scientificName": "Drosophila eugracilis",
            "fullName": "Drosophila eugracilis (Fruit fly)"
        },
        "name": "NADH-ubiquinone oxidoreductase chain 1",
        "description": [
            "Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone"
        ],
        "length": 315,
        "sequence": "MFYMEFVLSLIGSLLLIICVLVSVAFLTLLERKVLGYIQIRKGPNKVGLMGIPQPFCDAIKLFTKEQTYPLLSNYLSYYISPIFSLFLSLIVWMCMPFFVKLYSFNLGGLFFLCCTSLGVYTVMIAGWSSNSNYALLGGLRAVAQTISYEVSLALILLSFIFLIGSYNMIYFYYYQIYMWFLIILFPMALVWLTISLAETNRTPFDFAEGESELVSGFNVEYSSGGFALIFMAEYASILFMSMLFCVIFLGCDVFNLLFYIKLTFISFVFIWARGTLPRFRYDKLMYLAWKCFLSFSLNYLLFFIGFKILLFSLL",
        "proteome": null,
        "gene": "ND1",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "864b30094953a8b5e4deba394bc1ff33053fe7c1",
        "counters": {
            "domain_architectures": 93545,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 2,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 93545
        }
    }
}