General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8F0ZU91",
        "id": "A0A8F0ZU91_9PEZI",
        "source_organism": {
            "taxId": "1543685",
            "scientificName": "Colletotrichum gigasporum",
            "fullName": "Colletotrichum gigasporum"
        },
        "name": "Chitin synthase",
        "description": [
            "Polymerizes chitin, a structural polymer of the cell wall and septum, by transferring the sugar moiety of UDP-GlcNAc to the non-reducing end of the growing chitin polymer"
        ],
        "length": 93,
        "sequence": "DAWKKIVVCVVSDGRAKINPRTRALLAGMGVYQEGIAKQQVNGKDVTAHIYEYTTQVGMTIKNDVVSLVPKQQPVQLLFCLKEKNQKKINSHR",
        "proteome": null,
        "gene": "CHS",
        "go_terms": [
            {
                "identifier": "GO:0004100",
                "name": "chitin synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016758",
                "name": "hexosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "42e786a75f6b105138eee2f2281134e364a4980e",
        "counters": {
            "domain_architectures": 2629,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2629
        }
    }
}