GET /api/protein/UniProt/A0A8E2I9M7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8E2I9M7",
        "id": "A0A8E2I9M7_9BACI",
        "source_organism": {
            "taxId": "38875",
            "scientificName": "Heyndrickxia oleronia",
            "fullName": "Heyndrickxia oleronia"
        },
        "name": "Flavohemoprotein",
        "description": [
            "Is involved in NO detoxification in an aerobic process, termed nitric oxide dioxygenase (NOD) reaction that utilizes O(2) and NAD(P)H to convert NO to nitrate, which protects the bacterium from various noxious nitrogen compounds. Therefore, plays a central role in the inducible response to nitrosative stress"
        ],
        "length": 408,
        "sequence": "MLSQKTIDIIKSTAPILETEGKKITTCFYKMMFEAHPELLNIFNHVNQKQGRQQTALANTVYAAAKYIDQLEVIVPTVTQIAHKHRGLGIKPEHYPIVGEFLLKAIKEVLGDAATDEIIGAWGEAYGVIAQAFIDVEKGMYNAAANQENGWMDFKDFTVVKKEQESNVITSFYLKPADGSGVTTFVPGQYLTVRVNIPGEEYLLNRQYSLSCAPGHDYYRISVKKEKDFEPNGKVSNYLHDHVQVGDTIEISAPSGNFTLNMEETAPVALISGGVGLTPMMSMLETLANNESKREVYFVHAARNEEFHAFKETVRDLTDKLENGHAYYGYEKPLYSDGNHHFEGYLSKVFLQNLVTKETITYICGPVPFLKNTVQILTDLGVKKENIRYEFFGPAMDLTAEEKSEVTA",
        "proteome": "UP000189761",
        "gene": "hmp",
        "go_terms": [
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019825",
                "name": "oxygen binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008941",
                "name": "nitric oxide dioxygenase NAD(P)H activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0071949",
                "name": "FAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051409",
                "name": "response to nitrosative stress",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "713e025959139750ad8e51058a12356c0309b5d8",
        "counters": {
            "domain_architectures": 10721,
            "entries": 26,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 5,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "cathgene3d": 3,
                "cdd": 2,
                "ssf": 3,
                "pfam": 3,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "prints": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10721
        }
    }
}