GET /api/protein/UniProt/A0A8D2QIT9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8D2QIT9",
"id": "A0A8D2QIT9_ZONAL",
"source_organism": {
"taxId": "44394",
"scientificName": "Zonotrichia albicollis",
"fullName": "Zonotrichia albicollis (White-throated sparrow)"
},
"name": "Glutaredoxin-2, mitochondrial",
"description": [
"Glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress. Acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. Can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release"
],
"length": 105,
"sequence": "LKQEIVSDIISRNCVVIFSKTTCSYCSMIKNLFKGLNVSYTAVELDLNRNGKQFQDILEQMTGGRTVPRVFINGTCVGGATDAQRLHEEGKLLPLINQCKSKQPC",
"proteome": "UP000694413",
"gene": "GLRX2",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d2844775b51693340b21c3e9e12379eeddc0df70",
"counters": {
"domain_architectures": 69322,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 69322
}
}
}