GET /api/protein/UniProt/A0A8D2I318/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8D2I318",
"id": "A0A8D2I318_UROPR",
"source_organism": {
"taxId": "9999",
"scientificName": "Urocitellus parryii",
"fullName": "Urocitellus parryii (Arctic ground squirrel)"
},
"name": "Leupaxin",
"description": [
"Transcriptional coactivator for androgen receptor (AR) and serum response factor (SRF). Contributes to the regulation of cell adhesion, spreading and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events. Suppresses the integrin-induced tyrosine phosphorylation of paxillin (PXN)"
],
"length": 386,
"sequence": "MEELDALLEELEQSTLQDNDEYSNPAPPSLDQHSKKESNLAEASKILPHQGNTNPSSVQLVYTTSIQEPNVYSEVQEPKESPPLPKTSAAAQLDELMAHLSEMQAKVVMKADASKKQFPDKQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKMIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPKDYHHLFSPRCAYCAAPIVDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDNVWHPECFVCGDCFSTFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGHKFHPEHFVCAFCLTQLSKGIFREQNDKTYCQSCFNKLFSL",
"proteome": "UP000694417",
"gene": "LPXN",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b34e894464458d52d0b9522a0550a5211803efc6",
"counters": {
"domain_architectures": 3307,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"cdd": 2,
"pirsf": 1,
"panther": 1,
"prosite": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3307
}
}
}