General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8D2I318",
        "id": "A0A8D2I318_UROPR",
        "source_organism": {
            "taxId": "9999",
            "scientificName": "Urocitellus parryii",
            "fullName": "Urocitellus parryii (Arctic ground squirrel)"
        },
        "name": "Leupaxin",
        "description": [
            "Transcriptional coactivator for androgen receptor (AR) and serum response factor (SRF). Contributes to the regulation of cell adhesion, spreading and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events. Suppresses the integrin-induced tyrosine phosphorylation of paxillin (PXN)"
        ],
        "length": 386,
        "sequence": "MEELDALLEELEQSTLQDNDEYSNPAPPSLDQHSKKESNLAEASKILPHQGNTNPSSVQLVYTTSIQEPNVYSEVQEPKESPPLPKTSAAAQLDELMAHLSEMQAKVVMKADASKKQFPDKQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKMIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPKDYHHLFSPRCAYCAAPIVDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDNVWHPECFVCGDCFSTFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGHKFHPEHFVCAFCLTQLSKGIFREQNDKTYCQSCFNKLFSL",
        "proteome": "UP000694417",
        "gene": "LPXN",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b34e894464458d52d0b9522a0550a5211803efc6",
        "counters": {
            "domain_architectures": 3307,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "cdd": 2,
                "pirsf": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3307
        }
    }
}