HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8D2FIP4",
"id": "A0A8D2FIP4_THEGE",
"source_organism": {
"taxId": "9565",
"scientificName": "Theropithecus gelada",
"fullName": "Theropithecus gelada (Gelada baboon)"
},
"name": "Tryptophan 2,3-dioxygenase",
"description": [
"Heme-dependent dioxygenase that catalyzes the oxidative cleavage of the L-tryptophan (L-Trp) pyrrole ring and converts L-tryptophan to N-formyl-L-kynurenine. Catalyzes the oxidative cleavage of the indole moiety"
],
"length": 406,
"sequence": "MSGCPFLGNNFGCAFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSEIKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFISIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD",
"proteome": "UP000694411",
"gene": "TDO2",
"go_terms": [
{
"identifier": "GO:0020037",
"name": "heme binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019441",
"name": "L-tryptophan catabolic process to L-kynurenine",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004833",
"name": "L-tryptophan 2,3-dioxygenase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8d5d1cadb593a9d959b68328dd8ea7a987ace2cf",
"counters": {
"domain_architectures": 6841,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"panther": 1,
"pfam": 1,
"hamap": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6841
}
}
}