GET /api/protein/UniProt/A0A8D2EDJ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8D2EDJ5",
        "id": "A0A8D2EDJ5_THEGE",
        "source_organism": {
            "taxId": "9565",
            "scientificName": "Theropithecus gelada",
            "fullName": "Theropithecus gelada (Gelada baboon)"
        },
        "name": "GPI ethanolamine phosphate transferase 1",
        "description": [
            "Ethanolamine phosphate transferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers ethanolamine phosphate to the first alpha-1,4-linked mannose of the glycosylphosphatidylinositol precursor of GPI-anchor"
        ],
        "length": 395,
        "sequence": "MLLFFTLGLLIHFVFFASIFDIYFTSPLVHGMTPQFTPLPPPARRLVLFVADGLRADTLYELDENGTSRAPFIRNIIMHEGSWGISHTRVPTESRPGHVALIAGFYEDVSAVAKGWKENPVEFDSLFNESKYTWSWGSPDILPMFAKGASGDHVYTYSYDAKREDFGAQDATKLDTWVFDNVKDFFRHARNNQSLFSKINEEKIVFFLHLLGIDTNGHAHRPSSRDYKDNIKKVDDGVKEIVSMFNHFYGNDGKTTFIFTSDHGMTDWGSHGAGHPSETLTPLVTWGAGINYPQRVSAQQFDDSFLKEWRLENWKRLDVNQADIAPLMTSLIGVPFPLNSVGILPVDYLNNTDLFKAESMFTNAVQILEQFKVKMTQKKEVTLPFLFTPFNCAGS",
        "proteome": "UP000694411",
        "gene": "PIGN",
        "go_terms": [
            {
                "identifier": "GO:0051377",
                "name": "mannose-ethanolamine phosphotransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006506",
                "name": "GPI anchor biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005789",
                "name": "endoplasmic reticulum membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "74303254b231460c01e998a8e55327bf5058fe75",
        "counters": {
            "domain_architectures": 41960,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 41960
        }
    }
}