HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C9VMT5",
"id": "A0A8C9VMT5_SCLFO",
"source_organism": {
"taxId": "113540",
"scientificName": "Scleropages formosus",
"fullName": "Scleropages formosus (Asian bonytongue)"
},
"name": "Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial",
"description": [
"GTP-specific succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The beta subunit provides nucleotide specificity of the enzyme and binds the substrate succinate, while the binding sites for coenzyme A and phosphate are found in the alpha subunit"
],
"length": 409,
"sequence": "MLFQCSLQSNPRRWLNLQEYQSKKLMQDSGVTVQRFFVAETPSAALEAARKLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPAVVGELANKMLGFNLTTKQTPKEGVKVKTVMVAEALDIARETYFAILMDRSCNGPVMVGSPQGGVDIEEVAAKTPELIFKEVIDIFEGVRDEQALRMAVNLGFKGPLERQAADQIKKLYDLFLKVDATQVEVNPLGETPEGRVVCFDAKINFDDNAEFRQKDVFAMEDMTESDPTEMEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIDLHGGKPANFLDLGGGVKENQVYQAFKLLSADPKVEAILVNIFGGIVNCAIVAKGITKACRELELKVPLVVRLEGTNVQEAKRILSESGLPIMAANDLDDAARKAVASIAKK",
"proteome": "UP000694397",
"gene": "SUCLG2",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004776",
"name": "succinate-CoA ligase (GDP-forming) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006104",
"name": "succinyl-CoA metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006099",
"name": "tricarboxylic acid cycle",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "affbd9856777cc0cb3e3046ae941f1e287e103d5",
"counters": {
"domain_architectures": 28520,
"entries": 21,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 2,
"pfam": 2,
"hamap": 2,
"panther": 1,
"pirsf": 1,
"ncbifam": 2,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 28520
}
}
}