GET /api/protein/UniProt/A0A8C9SQ23/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C9SQ23",
        "id": "A0A8C9SQ23_SCLFO",
        "source_organism": {
            "taxId": "113540",
            "scientificName": "Scleropages formosus",
            "fullName": "Scleropages formosus (Asian bonytongue)"
        },
        "name": "Protein FRG1",
        "description": [
            "Binds to mRNA in a sequence-independent manner. May play a role in regulation of pre-mRNA splicing or in the assembly of rRNA into ribosomal subunits. May be involved in mRNA transport. May be involved in epigenetic regulation of muscle differentiation through regulation of activity of the histone-lysine N-methyltransferase KMT5B"
        ],
        "length": 250,
        "sequence": "MAEYSRVKSTKLVLKGLTDKSKKKKHKDRKRKGEDEAGKVDIVGGWWAVSNLGEITGTVAIEMHGRSYVHALDTGLFTVGAPHKEDEGPDPPEQFTAVKLSDTRIALKSGYGKYLGVSSEGVVTGRSDAIGSREQWEPVFQDGKMALLAANSCFVSYSEDGDIVAKSKMAGEEEMLKIRCCAEREEKKNDDIADEDRGNVKSCEINYVKKFQSFQDHRLRVNEGDCSELKKARLDGKFHEALLDRYVKRS",
        "proteome": "UP000694397",
        "gene": "FRG1",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c7ef94d071d1ccd3c99f4161b0714a2ea25d1b4e",
        "counters": {
            "domain_architectures": 3906,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3906
        }
    }
}