General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C9KAH7",
        "id": "A0A8C9KAH7_PANTA",
        "source_organism": {
            "taxId": "74533",
            "scientificName": "Panthera tigris altaica",
            "fullName": "Panthera tigris altaica (Siberian tiger)"
        },
        "name": "Nephronectin",
        "description": [
            "Functional ligand of integrin alpha-8/beta-1 in kidney development. Regulates the expression of GDNF with integrin alpha-8/beta-1 which is essential for kidney development. May also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins"
        ],
        "length": 599,
        "sequence": "ADFFFSFCFDMWPRQIVSSIGLCRYGGRIDCCWGWARRSWGQCQPFYVLRQRIARIRCQLKAVCQPQCKHGECIGPNKCKCHPGYAGKTCSQDEHFYPTPLDQGSEQPLFQPLDHQATSLPSRDLNECGLKPRPCKHRCMNTYGSYKCYCLNGYMLMPDGSCSIXXXXXXXXXXXCSMANCQYGCDVVKGQIRCQCPSPGLQLAPDGRTCMDVDECATGRVSCPRFRQCVNTFGSYICKCHKGFDLMYIAGKYQCHDIDECSLGQYQCSRFARCYNLHGSYKCKCKDGYQGDGLSCVYIPKVMIEPSGPIHVPKGNGTISKGDGGHSNWIPDVGSTRWPLKTPYIPPATNRPTFKPTIRPTPEPTPQPTPPPSIEFGTSPITTPERPSTRLTTVLPVATTSPRWITVDNRIQTDPQKPRGDVFIPRQPSNDLFEIFEIERGVSADDEAKDDPGVLIHSCNFDHGLCGWIREKDSDLHWEPVRDPAGGQYLTVSGAKGPGGKAARLVLPLGHLMHSGDLCLSFRHKVTGLHSGTLQVFVRKHGAHGAALWGRNGGRGWRHTQITLRGADVKSVIFRGEKRRGHTGEIGLDDVSLRKGHCS",
        "proteome": "UP000675900",
        "gene": "NPNT",
        "go_terms": [
            {
                "identifier": "GO:0005509",
                "name": "calcium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "c9820a8319930ad8f1784423f875de526c8a61c0",
        "counters": {
            "domain_architectures": 286,
            "entries": 32,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 4,
                "smart": 3,
                "ssf": 3,
                "cdd": 2,
                "profile": 2,
                "panther": 1,
                "prosite": 4,
                "interpro": 11
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 286
        }
    }
}