GET /api/protein/UniProt/A0A8C9J3S1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C9J3S1",
"id": "A0A8C9J3S1_PANTA",
"source_organism": {
"taxId": "74533",
"scientificName": "Panthera tigris altaica",
"fullName": "Panthera tigris altaica (Siberian tiger)"
},
"name": "Bcl-2-like protein 2",
"description": [
"Promotes cell survival. Blocks dexamethasone-induced apoptosis. Mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX"
],
"length": 193,
"sequence": "MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK",
"proteome": "UP000675900",
"gene": "BCL2L2",
"go_terms": [
{
"identifier": "GO:0042981",
"name": "regulation of apoptotic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e6df88747055402b85860b0fcaeda48c25af010f",
"counters": {
"domain_architectures": 1961,
"entries": 24,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"smart": 2,
"cdd": 1,
"profile": 2,
"panther": 1,
"pfam": 2,
"prints": 2,
"prosite": 3,
"interpro": 9
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1961
}
}
}