GET /api/protein/UniProt/A0A8C9IQ30/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C9IQ30",
"id": "A0A8C9IQ30_9PRIM",
"source_organism": {
"taxId": "591936",
"scientificName": "Piliocolobus tephrosceles",
"fullName": "Piliocolobus tephrosceles (Ugandan red Colobus)"
},
"name": "Tetraspanin",
"description": [
"Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling. Participates thereby in diverse biological functions such as cell signal transduction, adhesion, migration and protein trafficking. Regulates neuronal differentiation in response to NGF by facilitating NGF-mediated activation of NTRK1/TRKA receptor tyrosine kinase and subsequent downstream signaling pathways. Plays a role in the inhibition of TNFalpha-induced apoptosis. Mechanistically, inhibits the NF-kappa-B signaling pathway by blocking phosphorylation of CHUK. Also promotes the stability of the thiamine transporter 1/SLC19A2 in intestinal epithelial cells leading to an increase of thiamine uptake process"
],
"length": 240,
"sequence": "MQCFSFIKTIMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFLIAAGAVVFALGFLGCYGAQTESKCALMTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTLLVVPAIKKDYGSQKDFTQVWNTTMTELKCCGFTNYTDFEDSPYVRENNAFPPFCCNNVTNTANETCTKEKADDQKVQGCFQQLLYDIRTNAVTVGGVAAGIGGLELAAMIVSMYLYCNLQ",
"proteome": "UP000694416",
"gene": "TSPAN1",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2f035c93bc0f873636b5d7b827745b2654062619",
"counters": {
"domain_architectures": 63859,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"cathgene3d": 1,
"ssf": 1,
"pirsf": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 63859
}
}
}