GET /api/protein/UniProt/A0A8C9IC06/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C9IC06",
"id": "A0A8C9IC06_9PRIM",
"source_organism": {
"taxId": "591936",
"scientificName": "Piliocolobus tephrosceles",
"fullName": "Piliocolobus tephrosceles (Ugandan red Colobus)"
},
"name": "Phospholysine phosphohistidine inorganic pyrophosphate phosphatase",
"description": [
"Phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. Has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency"
],
"length": 270,
"sequence": "MAPWGERLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKGSRLKVRFCTNESQKSRAELVGQLRRLGFDISEGEVTAPAPAACQILKERGLRPYLLIHDGVRSEFGQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELENPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHTDK",
"proteome": "UP000694416",
"gene": "LHPP",
"go_terms": [
{
"identifier": "GO:0016791",
"name": "phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016311",
"name": "dephosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e39eac487bc4db226689882ed9a0cd550bf387a9",
"counters": {
"domain_architectures": 32478,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cdd": 1,
"cathgene3d": 1,
"pfam": 2,
"panther": 1,
"sfld": 2,
"ncbifam": 2,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 32478
}
}
}