GET /api/protein/UniProt/A0A8C9IAN5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C9IAN5",
"id": "A0A8C9IAN5_9PRIM",
"source_organism": {
"taxId": "591936",
"scientificName": "Piliocolobus tephrosceles",
"fullName": "Piliocolobus tephrosceles (Ugandan red Colobus)"
},
"name": "Glutathione S-transferase P",
"description": [
"Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). Participates in the formation of novel hepoxilin regioisomers. Negatively regulates CDK5 activity via p25/p35 translocation to prevent neurodegeneration"
],
"length": 174,
"sequence": "MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTMETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTFLRHLGRTLGLYGKDQREAALVDMVNDGVEDLRCKYLSLIYTNYISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVARLSARPKLKAFLASPEHANLPINGNGKQ",
"proteome": "UP000694416",
"gene": "GSTP1",
"go_terms": [
{
"identifier": "GO:0004364",
"name": "glutathione transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "15fd19a96419b5d82e8446b927c5a1c8ba3b6c79",
"counters": {
"domain_architectures": 49840,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 2,
"ssf": 2,
"cdd": 1,
"pfam": 2,
"cathgene3d": 2,
"panther": 1,
"prints": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 49840
}
}
}