General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C9CBZ8",
        "id": "A0A8C9CBZ8_PHOSS",
        "source_organism": {
            "taxId": "42100",
            "scientificName": "Phocoena sinus",
            "fullName": "Phocoena sinus (Vaquita)"
        },
        "name": "Pancreatic polypeptide",
        "description": [
            "Hormone secreted by pancreatic cells that acts as a regulator of pancreatic and gastrointestinal functions probably by signaling through the G protein-coupled receptor NPY4R2"
        ],
        "length": 105,
        "sequence": "MAASRRCLFLLLLSTGVALLLQPPLGARGTPLEPVYPGDNATPEQMAQYAAELRRYINMLTRPSVGPSYLSPPRYGKRDKEGALDFSECGSPHAAAPRQLSPRDS",
        "proteome": "UP000694554",
        "gene": "PPY",
        "go_terms": [
            {
                "identifier": "GO:0005179",
                "name": "hormone activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6279cb783756ed8ae54db8f117a2668ccd3784a1",
        "counters": {
            "domain_architectures": 2675,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "smart": 1,
                "cdd": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2675
        }
    }
}