General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C9BC38",
        "id": "A0A8C9BC38_PHOSS",
        "source_organism": {
            "taxId": "42100",
            "scientificName": "Phocoena sinus",
            "fullName": "Phocoena sinus (Vaquita)"
        },
        "name": "N(6)-L-threonylcarbamoyladenine synthase",
        "description": [
            "Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in mitochondrial tRNAs that read codons beginning with adenine. Probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Involved in mitochondrial genome maintenance"
        ],
        "length": 414,
        "sequence": "MLILNKTAGVFSKPSKRNMYEFLRSFHFHPGKRFLHKLVLGIETSCDDTAAAVVDETGNVLGEAIHSQTEVHLKTGGIIPPVAQQLHRENIQRIVQEALSASKVSPSELSAIATTIKPGLALSLGVGLSFSLQLVDQLKKPFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLALVRGVSDFLLLGKSLDIAPGDMLDKVARRLSLIKHPECSTMSGGKAIEHLAKQGNRLHFDFKPPMQHAKNCDFSFSGLRHIIDKMIMQKEKEEGIEKGQILSSAADIAAAVQHTVACHIAKRTHRAILFCKQRDLFCQSNAVLVVSGGVASNLHIRKALEIVTDATQCTLLCPPPRLCTDNGVMIAWNGVERLRAGLGILHSTEGIRYEPKCPLGADISKEVGEAAVKVPRLKMKI",
        "proteome": "UP000694554",
        "gene": "OSGEPL1",
        "go_terms": [
            {
                "identifier": "GO:0002949",
                "name": "tRNA threonylcarbamoyladenosine modification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7b9abc2a1639562e73a52cbc6da89a4b5eb7adec",
        "counters": {
            "domain_architectures": 61776,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 2,
                "pfam": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 61776
        }
    }
}