HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C9ATW6",
"id": "A0A8C9ATW6_PHOSS",
"source_organism": {
"taxId": "42100",
"scientificName": "Phocoena sinus",
"fullName": "Phocoena sinus (Vaquita)"
},
"name": "5-hydroxytryptamine receptor 4",
"description": [
"G-protein coupled receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone and a mitogen. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of downstream effectors. HTR4 is coupled to G(s) G alpha proteins and mediates activation of adenylate cyclase activity"
],
"length": 388,
"sequence": "MDELDANVSSKEGFGSVEKVVLLTFLSAVILMAVLGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDVWIYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLHIALMLGGCWVIPLFISFLPIMQGWNNVGIIDLIENRKFNKNSNSTYCIFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKGHAHQIQMLQRAGAPSEGRPQPADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFVDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRHAFLIILCCDNERYRRPSVLGQTVPCSTTTINGSTHVLRDAVECGGQWESQSHPPTTSSLVAAQPSDT",
"proteome": "UP000694554",
"gene": "HTR4",
"go_terms": [
{
"identifier": "GO:0004930",
"name": "G protein-coupled receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007186",
"name": "G protein-coupled receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0004993",
"name": "G protein-coupled serotonin receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007268",
"name": "chemical synaptic transmission",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0032098",
"name": "regulation of appetite",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005886",
"name": "plasma membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "587fa3dbe4504dc051049f3cca904dd9ab631b87",
"counters": {
"domain_architectures": 394800,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"smart": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"prints": 2,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 394800
}
}
}