GET /api/protein/UniProt/A0A8C8UM95/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C8UM95",
"id": "A0A8C8UM95_PERMB",
"source_organism": {
"taxId": "230844",
"scientificName": "Peromyscus maniculatus bairdii",
"fullName": "Peromyscus maniculatus bairdii (Prairie deer mouse)"
},
"name": "15-oxoprostaglandin 13-reductase",
"description": [
"Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-keto-PGE1, 15-keto-PGE2, 15-keto-PGE1-alpha and 15-keto-PGE2-alpha with highest efficiency towards 15-keto-PGE2-alpha. Overexpression represses transcriptional activity of PPARG and inhibits adipocyte differentiation"
],
"length": 377,
"sequence": "MLRLTAAGARAIVDMSYARHFLDFQGSAIPRAMQKLVVTRLSPNFREAVTLRRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYVAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLQELGELSEGKKVLVTAAAGGTGQFAVQLSKIAKCHVIGTCSSDEKLAFLKSIGCDRPINYKTEPVETVLKQEYPEGVDVVYESVGGAMFDLAVDALAIKGRLMVIGFISGYQSPSGLSPVKAGALPAKLLRKSASLRGFFLNHYLSKYQAAMEHLLELYTHGELVCEVDLGQLAPEGRFIGLDSIFRAVDYMYTGKNIGKLVVELPHSVSSKL",
"proteome": "UP000694547",
"gene": "Ptgr3",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6e6b076d581cf5733167d9dad5b9a31c66e6d8d3",
"counters": {
"domain_architectures": 323634,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"ssf": 2,
"cathgene3d": 2,
"smart": 1,
"pfam": 2,
"panther": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 323634
}
}
}