GET /api/protein/UniProt/A0A8C8T684/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C8T684",
        "id": "A0A8C8T684_PERMB",
        "source_organism": {
            "taxId": "230844",
            "scientificName": "Peromyscus maniculatus bairdii",
            "fullName": "Peromyscus maniculatus bairdii (Prairie deer mouse)"
        },
        "name": "Kazal-like domain-containing protein",
        "description": [
            "In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production",
            "Serine protease inhibitor which exhibits anti-trypsin activity. In the pancreas, protects against trypsin-catalyzed premature activation of zymogens"
        ],
        "length": 78,
        "sequence": "MKVATIFLGALVLLSLAGNITADFVGKKADCNYGVTGCPRIYDPVCGMDGITYSNECTLCSENRERQVPVLIRKYGPC",
        "proteome": "UP000694547",
        "gene": "Spink1",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004867",
                "name": "serine-type endopeptidase inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c9cee9028c061b657a0f21c49bbf139d3df736dd",
        "counters": {
            "domain_architectures": 6700,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6700
        }
    }
}