HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C8T684",
"id": "A0A8C8T684_PERMB",
"source_organism": {
"taxId": "230844",
"scientificName": "Peromyscus maniculatus bairdii",
"fullName": "Peromyscus maniculatus bairdii (Prairie deer mouse)"
},
"name": "Kazal-like domain-containing protein",
"description": [
"In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production",
"Serine protease inhibitor which exhibits anti-trypsin activity. In the pancreas, protects against trypsin-catalyzed premature activation of zymogens"
],
"length": 78,
"sequence": "MKVATIFLGALVLLSLAGNITADFVGKKADCNYGVTGCPRIYDPVCGMDGITYSNECTLCSENRERQVPVLIRKYGPC",
"proteome": "UP000694547",
"gene": "Spink1",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004867",
"name": "serine-type endopeptidase inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c9cee9028c061b657a0f21c49bbf139d3df736dd",
"counters": {
"domain_architectures": 6700,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6700
}
}
}