General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C7U7G2",
        "id": "A0A8C7U7G2_ONCMY",
        "source_organism": {
            "taxId": "8022",
            "scientificName": "Oncorhynchus mykiss",
            "fullName": "Oncorhynchus mykiss (Rainbow trout)"
        },
        "name": "Translin",
        "description": [
            "DNA-binding protein that specifically recognizes consensus sequences at the breakpoint junctions in chromosomal translocations, mostly involving immunoglobulin (Ig)/T-cell receptor gene segments. Seems to recognize single-stranded DNA ends generated by staggered breaks occurring at recombination hot spots",
            "Exhibits both single-stranded and double-stranded endoribonuclease activity. May act as an activator of RNA-induced silencing complex (RISC) by facilitating endonucleolytic cleavage of the siRNA passenger strand"
        ],
        "length": 222,
        "sequence": "MEKLEGLPVTPFMDRDKDIRKVVQVLEQTAREILTLLQSVHQPSGFKEIPSKCQKARELFCTVRTHLGELKTKFPVDQYYRFHEHWRFVLQRLAFLAAFVVYLESESLVTREEVAQILGIEVVREKGFHLDVEDYLAGVLIMASELSRLAVNSVTAGDYSRPLRISNFINELDSGFRLLNLKNDPLRKRYDGLKYDVKKIEEVVYDLSIRGLSKELEAGGDK",
        "proteome": "UP000694395",
        "gene": "LOC110501801",
        "go_terms": [
            {
                "identifier": "GO:0043565",
                "name": "sequence-specific DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003697",
                "name": "single-stranded DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016070",
                "name": "RNA metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "609b1432c372911cb78c464d2d7b7252a4536b5f",
        "counters": {
            "domain_architectures": 7976,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7976
        }
    }
}