GET /api/protein/UniProt/A0A8C7SGK3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C7SGK3",
"id": "A0A8C7SGK3_ONCMY",
"source_organism": {
"taxId": "8022",
"scientificName": "Oncorhynchus mykiss",
"fullName": "Oncorhynchus mykiss (Rainbow trout)"
},
"name": "LIM domain-containing protein",
"description": [
"Within the IPP (ILK-PINCH-PARVIN) complex, binds to F-actin, promoting F-actin bundling, a process required to generate force for actin cytoskeleton reorganization and subsequent dynamic cell adhesion events such as cell spreading and migration"
],
"length": 394,
"sequence": "MCQPQPPTILENGEAQDPEPHPAEFNGHRHANGGEAELPVSKSQRRRSDVKVYKEFCDFYARFNMASALANAICERCKSGFAPAEKIVNSNGELYHEGCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPDCFCCDLCQAVLADVGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIEEQPLLFKNDPYHPDHFNCNNCGKELTADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCYHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEVDLKPVCKHCYERLPDDMKLRLAKREKEKTKKVPMCL",
"proteome": "UP000694395",
"gene": "LOC110501702",
"go_terms": [
{
"identifier": "GO:0005925",
"name": "focal adhesion",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6cc354fde23e442f76e6ef776b6d70b17bf9729b",
"counters": {
"domain_architectures": 4315,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"smart": 1,
"pfam": 1,
"cdd": 5,
"panther": 1,
"pirsf": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4315
}
}
}