GET /api/protein/UniProt/A0A8C7SGK3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C7SGK3",
        "id": "A0A8C7SGK3_ONCMY",
        "source_organism": {
            "taxId": "8022",
            "scientificName": "Oncorhynchus mykiss",
            "fullName": "Oncorhynchus mykiss (Rainbow trout)"
        },
        "name": "LIM domain-containing protein",
        "description": [
            "Within the IPP (ILK-PINCH-PARVIN) complex, binds to F-actin, promoting F-actin bundling, a process required to generate force for actin cytoskeleton reorganization and subsequent dynamic cell adhesion events such as cell spreading and migration"
        ],
        "length": 394,
        "sequence": "MCQPQPPTILENGEAQDPEPHPAEFNGHRHANGGEAELPVSKSQRRRSDVKVYKEFCDFYARFNMASALANAICERCKSGFAPAEKIVNSNGELYHEGCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPDCFCCDLCQAVLADVGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIEEQPLLFKNDPYHPDHFNCNNCGKELTADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCYHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEVDLKPVCKHCYERLPDDMKLRLAKREKEKTKKVPMCL",
        "proteome": "UP000694395",
        "gene": "LOC110501702",
        "go_terms": [
            {
                "identifier": "GO:0005925",
                "name": "focal adhesion",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6cc354fde23e442f76e6ef776b6d70b17bf9729b",
        "counters": {
            "domain_architectures": 4315,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "pfam": 1,
                "cdd": 5,
                "panther": 1,
                "pirsf": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4315
        }
    }
}