General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C7LCN0",
        "id": "A0A8C7LCN0_ONCKI",
        "source_organism": {
            "taxId": "8019",
            "scientificName": "Oncorhynchus kisutch",
            "fullName": "Oncorhynchus kisutch (Coho salmon)"
        },
        "name": "Calponin",
        "description": [
            "Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity"
        ],
        "length": 345,
        "sequence": "MTQFNKGPVYGLTAELRSKIAGKYDLQKEEELRFWIEEVTGMPIGENFQKGLKDGVILCELINKLQPGSIKKINHSKLNWHKLENLGNFIRAILKFGLCPNDIFEANDLFENGNMTQVQSTLLSLAGVAKTKGSNSNCDLGVKYADKRTRHFDEEKMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKSQTDKPYDQTTISLQMGTNKGASQAGMSAPGTRRDIYDQKSAGQTADSSTISLQMGTNKVASQKGMSSYGLGRQIYDPKYCTSPTEPTSPVTLGNNAGSHGNGSLGTGTNGSEISDSDYQAEYQYHHDDEEEYRGGYQQQYSGHYDEDQGIDY",
        "proteome": "UP000694557",
        "gene": "CNN3",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003779",
                "name": "actin binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0031032",
                "name": "actomyosin structure organization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e4878a16e889441552d4ea91d77a43cb8c8893d0",
        "counters": {
            "domain_architectures": 2648,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 2,
                "pfam": 2,
                "smart": 1,
                "panther": 1,
                "prints": 2,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2648
        }
    }
}