GET /api/protein/UniProt/A0A8C7HIC6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C7HIC6",
"id": "A0A8C7HIC6_ONCKI",
"source_organism": {
"taxId": "8019",
"scientificName": "Oncorhynchus kisutch",
"fullName": "Oncorhynchus kisutch (Coho salmon)"
},
"name": "Mitochondrial import inner membrane translocase subunit TIM22",
"description": [
"Essential core component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. In the TIM22 complex, it constitutes the voltage-activated and signal-gated channel. Forms a twin-pore translocase that uses the membrane potential as external driving force in 2 voltage-dependent steps"
],
"length": 201,
"sequence": "MAATVGSGNASVSDTQASTSADRSYEGSTFQYSMVLEHLIGEKRPIKDLNPTVMGGLPNPMKTDDQKMIEQGMESCAFKAVLACVGGFVLGGAFGVFTAGIDTNVGFDPKDPMRTPTAREVLKDMGQRGMSYAKNFAVIGAMFSCTECIIESHRGKSDWKNAVYSGCVTGGAIGFRAGAKAGVLGCGGFAAFSAAIEYYLR",
"proteome": "UP000694557",
"gene": "TIMM22",
"go_terms": [
{
"identifier": "GO:0045039",
"name": "protein insertion into mitochondrial inner membrane",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0042721",
"name": "TIM22 mitochondrial import inner membrane insertion complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d248dad29de54a4a0cf8922bb2c3f57bcdeaa5f8",
"counters": {
"domain_architectures": 24356,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 24356
}
}
}