GET /api/protein/UniProt/A0A8C7GW72/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C7GW72",
"id": "A0A8C7GW72_ONCKI",
"source_organism": {
"taxId": "8019",
"scientificName": "Oncorhynchus kisutch",
"fullName": "Oncorhynchus kisutch (Coho salmon)"
},
"name": "DnaJ homolog subfamily B member 11",
"description": [
"As a co-chaperone for HSPA5 it is required for proper folding, trafficking or degradation of proteins. Binds directly to both unfolded proteins that are substrates for ERAD and nascent unfolded peptide chains, but dissociates from the HSPA5-unfolded protein complex before folding is completed. May help recruiting HSPA5 and other chaperones to the substrate. Stimulates HSPA5 ATPase activity. It is necessary for maturation and correct trafficking of PKD1"
],
"length": 361,
"sequence": "MAVKGMNLCSVCCLALYFVTAVLAGRDFYKILGVSKSASVRDIKKAYRKLALQLHPDRNQDDPTAADKFADLGSAYEVLSDEEKRKQYDAYGEDGLKEGHHGSHNDIFSSFFGDFGFMFGGNRQGQQDRNIPRGNDIVLDLEVTLEEVYSGNFVEVVRNKPVAKEAPGKRKCNCRQEMRTTQLGPGRFQMSQEVVCDECPNIKLVNEERTLEVEIEQGVRDEMEYPFIGEGEPHIDGEPGDLRFRIKVMKHPVFERRGDDLYTNVTISLVEALVGFEMDITHLDGHKVHIVRDKITKPGARVWKKGEGLPNFDNNNIRGSLIVSFDVEFPETQLNDNQKEGVRAILKQASVQKVYNGLQGY",
"proteome": "UP000694557",
"gene": "DNAJB11",
"go_terms": [
{
"identifier": "GO:0051082",
"name": "unfolded protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006457",
"name": "protein folding",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b36fbaa28ca2d38c62e70de9b499db9b7e495914",
"counters": {
"domain_architectures": 29478,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"smart": 1,
"cdd": 2,
"pfam": 2,
"profile": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 29478
}
}
}