GET /api/protein/UniProt/A0A8C7CL83/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C7CL83",
"id": "A0A8C7CL83_ONCKI",
"source_organism": {
"taxId": "8019",
"scientificName": "Oncorhynchus kisutch",
"fullName": "Oncorhynchus kisutch (Coho salmon)"
},
"name": "Solute carrier family 25 member 1",
"description": [
"Mitochondrial electroneutral antiporter that exports citrate from the mitochondria into the cytosol in exchange for malate. Also able to mediate the exchange of citrate for isocitrate, phosphoenolpyruvate, cis-aconitate and to a lesser extent trans-aconitate, maleate and succinate. In the cytoplasm, citrate plays important roles in fatty acid and sterol synthesis, regulation of glycolysis, protein acetylation, and other physiopathological processes"
],
"length": 296,
"sequence": "NKLNGAKPRHNPRGKAGGIAGGIEICITFPTEYVKTQLQLDEKANPPRYKGIVDCVKQTVDGHGVRGLYRGLSSLLYGSIPKAAVRFGMFEFLSNKMRDENGKLDSTRGLFCGLGAGMAEAVVVVCPMETVKVKFIHDQSSANPKYRGFFHGVGEIIRTEGLRGTYQGLTATVLKQGSNQAIRFYVMTSLRNWYKGDDPNKAINPLVTGAFGAFAGAVSVFGNTPLDVIKTRMQGLEAHKYKSTLDCAVKIMKHEGPKAFYKGTVPRLGRVCMDVAIVFIIYEEVVKVLNKVWKTD",
"proteome": "UP000694557",
"gene": "SLC25A1",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
"counters": {
"domain_architectures": 140476,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 140476
}
}
}