HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C7AG25",
"id": "A0A8C7AG25_NEOVI",
"source_organism": {
"taxId": "452646",
"scientificName": "Neovison vison",
"fullName": "Neovison vison (American mink)"
},
"name": "Histone H1.0",
"description": [
"Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The histones H1.0 are found in cells that are in terminal stages of differentiation or that have low rates of cell division"
],
"length": 194,
"sequence": "MTENSTSTPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKRSVAFKKTKKEVKKVATPKKAAKPKKAASKAPSKKPKATPVKKAKKKPAATPKKTKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK",
"proteome": "UP000694425",
"gene": "LOC122890832",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006334",
"name": "nucleosome assembly",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0000786",
"name": "nucleosome",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0030527",
"name": "structural constituent of chromatin",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2943c539f82d4a5b90c7c774de56019ef40d7d69",
"counters": {
"domain_architectures": 18414,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"cdd": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 18414
}
}
}