GET /api/protein/UniProt/A0A8C6YQE6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C6YQE6",
"id": "A0A8C6YQE6_NOTPE",
"source_organism": {
"taxId": "30464",
"scientificName": "Nothoprocta perdicaria",
"fullName": "Nothoprocta perdicaria (Chilean tinamou)"
},
"name": "Molybdopterin synthase sulfur carrier subunit",
"description": [
"Acts as a sulfur carrier required for molybdopterin biosynthesis. Component of the molybdopterin synthase complex that catalyzes the conversion of precursor Z into molybdopterin by mediating the incorporation of 2 sulfur atoms into precursor Z to generate a dithiolene group. In the complex, serves as sulfur donor by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. After interaction with MOCS2B, the sulfur is then transferred to precursor Z to form molybdopterin"
],
"length": 83,
"sequence": "MVAVLYFARSAELAGLRSETLSVPRRLTSLQLWEEIVKRHPRLAALRDQVVFAVRQEYVLLGDQLLVLHPGDEVAIIPPISGG",
"proteome": "UP000694420",
"gene": "MOCS2",
"go_terms": [
{
"identifier": "GO:0006777",
"name": "Mo-molybdopterin cofactor biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005829",
"name": "cytosol",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "988025fca511e4539000527d2c7d6cbbe579df07",
"counters": {
"domain_architectures": 46074,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 46074
}
}
}