General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C6YQE6",
        "id": "A0A8C6YQE6_NOTPE",
        "source_organism": {
            "taxId": "30464",
            "scientificName": "Nothoprocta perdicaria",
            "fullName": "Nothoprocta perdicaria (Chilean tinamou)"
        },
        "name": "Molybdopterin synthase sulfur carrier subunit",
        "description": [
            "Acts as a sulfur carrier required for molybdopterin biosynthesis. Component of the molybdopterin synthase complex that catalyzes the conversion of precursor Z into molybdopterin by mediating the incorporation of 2 sulfur atoms into precursor Z to generate a dithiolene group. In the complex, serves as sulfur donor by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. After interaction with MOCS2B, the sulfur is then transferred to precursor Z to form molybdopterin"
        ],
        "length": 83,
        "sequence": "MVAVLYFARSAELAGLRSETLSVPRRLTSLQLWEEIVKRHPRLAALRDQVVFAVRQEYVLLGDQLLVLHPGDEVAIIPPISGG",
        "proteome": "UP000694420",
        "gene": "MOCS2",
        "go_terms": [
            {
                "identifier": "GO:0006777",
                "name": "Mo-molybdopterin cofactor biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005829",
                "name": "cytosol",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "988025fca511e4539000527d2c7d6cbbe579df07",
        "counters": {
            "domain_architectures": 46074,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 46074
        }
    }
}