GET /api/protein/UniProt/A0A8C6REZ9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C6REZ9",
"id": "A0A8C6REZ9_NANGA",
"source_organism": {
"taxId": "1026970",
"scientificName": "Nannospalax galili",
"fullName": "Nannospalax galili (Northern Israeli blind subterranean mole rat)"
},
"name": "Wiskott-Aldrich syndrome protein family member",
"description": [
"Downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Promotes formation of actin filaments. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex"
],
"length": 493,
"sequence": "MPLVTRNIEPRHLCRQTLPSDTSELECRTNITLANVIRQLGSLSKYAEDIFREIFSQASTFASRVNSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDAPPPLNNLSPYRDDGKEALKFYTNPSYFFDLWKEKMLQDTKDMKEKRKHRKEKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGPSGHSSTLVYQNGSIGSVENVDTGSYPPPPQSDSTSSPSPSFSEDNLPPPPAEFSYPADNQRGSGVAGPKRTSVVSPSHPPPAPPLGSPPGPKPGFAPPPAPPPPPPMGVPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPEADYPMPPPPLSQPSGGAPPPPPPPPPPGPPPLPFSGDDGQPAGPPPISDVTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSEFDEDDWSN",
"proteome": "UP000694381",
"gene": "Wasf2",
"go_terms": [
{
"identifier": "GO:0003779",
"name": "actin binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030036",
"name": "actin cytoskeleton organization",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005856",
"name": "cytoskeleton",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "99e54a16c32a9b9abe70c4446a86aad7d54f4d1b",
"counters": {
"domain_architectures": 1815,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"pfam": 3,
"profile": 1,
"smart": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1815
}
}
}